PDB entry 2dm2

View 2dm2 on RCSB PDB site
Description: Solution structure of the first ig domain of human palladin
Class: protein binding
Keywords: beta-sandwich, KIAA0992, myopalladin, actin-associated scaffold, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-04-20, released 2007-04-24
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: palladin
    Species: Homo sapiens [TaxId:9606]
    Gene: KIAA0992
    Database cross-references and differences (RAF-indexed):
    • GB NP_057165 (7-103)
      • cloning artifact (0-6)
      • cloning artifact (104-109)
    Domains in SCOPe 2.06: d2dm2a1, d2dm2a2, d2dm2a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dm2A (A:)
    gssgssgapffemklkhykifegmpvtftcrvagnpkpkiywfkdgkqispksdhytiqr
    dldgtcslhttastldddgnytimaanpqgrisctgrlmvqavnsgpssg