PDB entry 2dlz

View 2dlz on RCSB PDB site
Description: Solution structure of the SH2 domain of human protein vav-2
Class: signaling protein
Keywords: Rho family Guanine nucleotide exchange factor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-20, released 2007-04-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein vav-2
    Species: Homo sapiens [TaxId:9606]
    Gene: VAV2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52735 (7-111)
      • cloning artifact (0-6)
      • cloning artifact (112-117)
    Domains in SCOPe 2.07: d2dlza1, d2dlza2, d2dlza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlzA (A:)
    gssgssgsreidytaypwfagnmerqqtdnllkshasgtylirerpaeaerfaisikfnd
    evkhikvvekdnwihiteakkfdsllelveyyqchslkesfkqldttlkypysgpssg