PDB entry 2dly

View 2dly on RCSB PDB site
Description: Solution structure of the SH2 domain of murine Fyn-related kinase
Class: transferase
Keywords: Brk family kinase, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSFERASE
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fyn-related kinase
    Species: Mus musculus [TaxId:10090]
    Gene: FrK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8BPC1 (7-114)
      • cloning artifact (0-6)
      • cloning artifact (115-120)
    Domains in SCOPe 2.08: d2dlya1, d2dlya2, d2dlya3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dlyA (A:)
gssgssgaedrslqaepwffgaikradaekqllysenqtgafliresesqkgdfslsvld
egvvkhyrirrldeggffltrrkvfstlnefvnyytttsdglcvklekpclkiqvsgpss
g