PDB entry 2dlx

View 2dlx on RCSB PDB site
Description: Solution structure of the UAS domain of human UBX domain-containing protein 7
Class: structural genomics, unknown function
Keywords: UAS domain, UBX domain-containing protein 7, Protein KIAA0794, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: UBX domain-containing protein 7
  Species: Homo sapiens [TaxId:9606]
  Gene: UBXD7, KIAA0794
  Database cross-references and differences (RAF-indexed):
  • Uniprot O94888 (7-146)
    • cloning artifact (0-6)
    • cloning artifact (147-152)
  Domains in SCOPe 2.08: d2dlxa1, d2dlxa2, d2dlxa3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dlxA (A:)
  gssgssgidkklttladlfrppidlmhkgsfetakecgqmqnkwlminiqnvqdfacqcl
  nrdvwsneavkniirehfifwqvyhdseegqryiqfyklgdfpyvsildprtgqklvewh
  qldvssfldqvtgflgehgqldglssssgpssg