PDB entry 2dlv

View 2dlv on RCSB PDB site
Description: Solution structure of the RGS domain of human regulator of G-protein signaling 18
Class: signaling protein
Keywords: RGS domain, Regulator of G-protein signaling 18, RGS18, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-20, released 2007-04-17
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulator of G-protein signaling 18
    Species: Homo sapiens [TaxId:9606]
    Gene: RGS18, RGS13
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NS28 (7-133)
      • cloning artifact (0-6)
      • cloning artifact (134-139)
    Domains in SCOPe 2.05: d2dlva_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dlvA (A:)
gssgssgspeeavkwgesfdkllshrdgleaftrflktefseeniefwiacedfkkskgp
qqihlkakaiyekfiqtdapkevnldfhtkevitnsitqptlhsfdaaqsrvyqlmeqds
ytrflksdiyldlmsgpssg