PDB entry 2dlo

View 2dlo on RCSB PDB site
Description: Solution structure of the second LIM domain of human Thyroid receptor-interacting protein 6
Class: cell adhesion
Keywords: LIM domain, Thyroid receptor interacting protein 6 (TRIP6), OPA-interacting protein 1, Zyxin related protein 1 (ZRP-1), Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, cell adhesion
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thyroid receptor-interacting protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIP6, OIP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15654 (7-74)
      • cloning artifact (0-6)
      • cloning artifact (75-80)
    Domains in SCOPe 2.08: d2dloa1, d2dloa2, d2dloa3, d2dloa4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dloA (A:)
gssgssgegcyvatlekcatcsqpildrilramgkayhpgcftcvvchrgldgipftvda
tsqihciedfhrkfasgpssg