PDB entry 2dlm

View 2dlm on RCSB PDB site
Description: Solution structure of the first SH3 domain of human vinexin
Class: cell adhesion
Keywords: SH3 domain, Vinexin, SH3-containing adapter molecule-1, SCAM-1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, cell adhesion
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Vinexin
    Species: Homo sapiens [TaxId:9606]
    Gene: SCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot O60504 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.06: d2dlma1, d2dlma2, d2dlma3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dlmA (A:)
    gssgssgkaarlkfdfqaqspkeltlqkgdivyihkevdknwlegehhgrlgifpanyve
    vlsgpssg