PDB entry 2dll

View 2dll on RCSB PDB site
Description: Solution structure of the IRF domain of human interferon regulator factors 4
Class: cytokine
Keywords: IRF domain, Interferon regulatory factor 4, Lymphocyte specific interferon regulatory factor, NF-EM5, Multiple myeloma oncogene 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, CYTOKINE
Deposited on 2006-04-20, released 2006-10-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Interferon regulatory factor 4
  Species: Homo sapiens [TaxId:9606]
  Gene: IRF4, MUM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q15306 (7-114)
    • cloning artifact (0-6)
    • cloning artifact (115-120)
  Domains in SCOPe 2.08: d2dlla1, d2dlla2, d2dlla3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dllA (A:)
  gssgssgklrqwlidqidsgkypglvweneeksifripwkhagkqdynreedaalfkawa
  lfkgkfregidkpdpptwktrlrcalnksndfeelversqldisdpykvyrivpesgpss
  g