PDB entry 2dli

View 2dli on RCSB PDB site
Description:
Deposited on 1999-03-08, released 2000-01-13
The last revision prior to the SCOP 1.71 freeze date was dated 2000-05-05, with a file datestamp of 2000-05-05.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.227
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2dlia1, d2dlia2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dliA (A:)
    vhrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskan
    fsigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlages
    vtlscssrssydmyhlsregeahecrfsagpkvngtfqadfplgpathggtyrcfgsfrd
    spyewsnssdpllvsvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dliA (A:)
    hrkpsllahpgrlvkseetvilqcwsdvrfehfllhregkfkdtlhligehhdgvskanf
    sigpmmqdlagtyrcygsvthspyqlsapsdpldivitglyekpslsaqpgptvlagesv
    tlscssrssydmyhlsregeahecrfsagpkvngtfqadfplgpathggtyrcfgsfrds
    pyewsnssdpllvsvi