PDB entry 2dld

View 2dld on RCSB PDB site
Description: d-lactate dehydrogenase complexed with nadh and oxamate
Deposited on 1995-10-28, released 1996-03-14
The last revision prior to the SCOP 1.55 freeze date was dated 1996-03-14, with a file datestamp of 1996-03-20.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dldA (A:)
    mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
    dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvyspnaiaehaaiqaarvlr
    qdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmrimegfgakviaydifkn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindksiaemkdgvvivncsrgrlv
    dtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrladlidrpnvlvtphtaf
    ytthavrnmvvkafnnnlklingekpdspvalnknkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dldB (B:)
    mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
    dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvyspnaiaehaaiqaarvlr
    qdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmrimegfgakviaydifkn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindksiaemkdgvvivncsrgrlv
    dtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrladlidrpnvlvtphtaf
    ytthavrnmvvkafnnnlklingekpdspvalnknkf