PDB entry 2dld

View 2dld on RCSB PDB site
Description: d-lactate dehydrogenase complexed with nadh and oxamate
Class: oxidoreductase (choh(d)-nad+(a))
Keywords: oxidoreductase (choh(d)-nad+(a))
Deposited on 1995-10-28, released 1996-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.195
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus helveticus [TaxId:1587]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dlda1, d2dlda2
  • Chain 'B':
    Compound: d-lactate dehydrogenase
    Species: Lactobacillus helveticus [TaxId:1587]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2dldb1, d2dldb2
  • Heterogens: NAI, OXM

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dldA (A:)
    mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
    dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvyspnaiaehaaiqaarvlr
    qdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmrimegfgakviaydifkn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindksiaemkdgvvivncsrgrlv
    dtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrladlidrpnvlvtphtaf
    ytthavrnmvvkafnnnlklingekpdspvalnknkf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dldB (B:)
    mtkvfayairkdeepflnewkeahkdidvdytdklltpetaklakgadgvvvyqqldyta
    dtlqaladagvtkmslrnvgvdnidmdkakelgfqitnvpvyspnaiaehaaiqaarvlr
    qdkrmdekmakrdlrwaptigrevrdqvvgvvgtghigqvfmrimegfgakviaydifkn
    pelekkgyyvdslddlykqadvislhvpdvpanvhmindksiaemkdgvvivncsrgrlv
    dtdavirgldsgkifgfvmdtyedevgvfnkdwegkefpdkrladlidrpnvlvtphtaf
    ytthavrnmvvkafnnnlklingekpdspvalnknkf