PDB entry 2dlb

View 2dlb on RCSB PDB site
Description: X-ray Crystal Structure of Protein yopT from Bacillus subtilis. Northeast Structural Genomics Consortium Target SR412
Class: structural genomics, unknown function
Keywords: sr412, X-Ray, NESG, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, UNKNOWN FUNCTION
Deposited on 2006-04-18, released 2006-04-25
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: 0.154
AEROSPACI score: 0.84 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: yopT
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34498
      • modified residue (59)
    Domains in SCOPe 2.01: d2dlba1
  • Chain 'B':
    Compound: yopT
    Species: Bacillus subtilis [TaxId:1423]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O34498
      • modified residue (59)
    Domains in SCOPe 2.01: d2dlbb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dlbA (A:)
    magylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdm
    eyeitnteelpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dlbA (A:)
    agylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdme
    yeitnteelp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dlbB (B:)
    magylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdm
    eyeitnteelpelehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dlbB (B:)
    agylnnialnleivlknkadspevsetlvtricenlllskevsflkadgsvenfklsdme
    yeitnteelp