PDB entry 2dl9

View 2dl9 on RCSB PDB site
Description: Solution structure of the Ig-like domain of human Leucine-rich repeat-containing protein 4
Class: membrane protein
Keywords: Ig-like domain, Leucine-rich repeat-containing protein 4, Brain tumor associated protein LRRC4, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, MEMBRANE PROTEIN
Deposited on 2006-04-17, released 2006-10-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leucine-rich repeat-containing protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: LRRC4, BAG, UNQ554/PRO1111
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HBW1 (7-96)
      • cloning artifact (0-6)
      • cloning artifact (97-102)
    Domains in SCOPe 2.07: d2dl9a1, d2dl9a2, d2dl9a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dl9A (A:)
    gssgssgpfimdaprdlnisegrmaelkcrtppmssvkwllpngtvlshasrhprisvln
    dgtlnfshvllsdtgvytcmvtnvagnsnasaylnvssgpssg