PDB entry 2dl8

View 2dl8 on RCSB PDB site
Description: Solution structure of the SH3 domain of human SLIT-ROBO Rho GTPase-activating protein 2
Class: signaling protein
Keywords: SH3 domain, SLIT-ROBO Rho GTPase activating protein 2, Formin-binding protein 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-17, released 2006-10-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: SLIT-ROBO Rho GTPase-activating protein 2
  Species: Homo sapiens [TaxId:9606]
  Gene: SRGAP2, FNBP2, KIAA0456
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75044 (7-65)
    • cloning artifact (0-6)
    • cloning artifact (66-71)
  Domains in SCOPe 2.04: d2dl8a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dl8A (A:)
  gssgssgepieaiakfdyvgrtarelsfkkgaslllyqrasddwwegrhngidgliphqy
  ivvqdtsgpssg