PDB entry 2dl5

View 2dl5 on RCSB PDB site
Description: Solution structure of the first SH3 domain of human KIAA0769 protein
Class: structural genomics, unknown function
Keywords: SH3 domain, KIAA0769, FCHSD2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-17, released 2006-10-17
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: KIAA0769 protein
    Species: Homo sapiens [TaxId:9606]
    Gene: FCHSD2, KIAA0769
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8WVM2 (7-71)
      • cloning artifact (0-6)
      • cloning artifact (72-77)
    Domains in SCOPe 2.06: d2dl5a1, d2dl5a2, d2dl5a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dl5A (A:)
    gssgssgtlrnypltckvvysykasqpdeltieehevleviedgdmedwvkarnkvgqvg
    yvpekylqfptssgpssg