PDB entry 2dkt

View 2dkt on RCSB PDB site
Description: Solution structure of the CHY zinc finger domain of the RING finger and CHY zinc finger domain-containing protein 1 from Mus musculus
Class: metal binding protein
Keywords: RING finger and CHY zinc finger domain-containing protein 1, Rchy1, CHY zinc finger domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2006-04-14, released 2006-10-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: RING finger and CHY zinc finger domain-containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: RCHY1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9CR50 (7-136)
      • cloning artifact (0-6)
      • cloning artifact (137-142)
    Domains in SCOPe 2.08: d2dkta1, d2dkta2, d2dkta3, d2dkta4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dktA (A:)
    gssgssggvrnlaqgprgcehydracllkapccdklytcrlchdtnedhqldrfkvkevq
    cinceklqhaqqtcedcstlfgeyycsichlfdkdkrqyhcescgicrigpkedffhclk
    cnlclttnlrgkhkciesgpssg