PDB entry 2dkl

View 2dkl on RCSB PDB site
Description: Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
Class: signaling protein
Keywords: Trinucleotide Repeat Containing 6C Protein, TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-12, released 2006-10-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Trinucleotide Repeat Containing 6C Protein
  Species: Homo sapiens [TaxId:9606]
  Gene: KIAA1582
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q86UE5 (7-78)
    • cloning artifact (0-6)
    • cloning artifact (79-84)
  Domains in SCOPe 2.07: d2dkla1, d2dkla2, d2dkla3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dklA (A:)
  gssgssggmktsgkqdeawimsrlikqltdmgfprepaeealksnnmnldqamsallekk
  vdvdkrglgvtdhngmaaksgpssg