PDB entry 2dkl

View 2dkl on RCSB PDB site
Description: Solution Structure of the UBA Domain in the Human Trinucleotide Repeat Containing 6C Protein (hTNRC6C)
Class: signaling protein
Keywords: Trinucleotide Repeat Containing 6C Protein, TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-12, released 2006-10-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-12, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Trinucleotide Repeat Containing 6C Protein
    Species: HOMO SAPIENS
    Gene: KIAA1582
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q86UE5 (7-78)
      • cloning artifact (0-6)
      • cloning artifact (79-84)
    Domains in SCOP 1.73: d2dkla1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dklA (A:)
    gssgssggmktsgkqdeawimsrlikqltdmgfprepaeealksnnmnldqamsallekk
    vdvdkrglgvtdhngmaaksgpssg