PDB entry 2dkk

View 2dkk on RCSB PDB site
Description: Structure/Function studies of Cytochrome P450 158A1 from Streptomyces Coelicolor A3(2)
Class: oxidoreductase
Keywords: streptomyces, Cytochrome P450 oxidoreductase, CYP158A1, inhibitor, OXIDOREDUCTASE
Deposited on 2006-04-12, released 2007-04-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.97 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome p450
    Species: STREPTOMYCES COELICOLOR [TaxId:100226]
    Database cross-references and differences (RAF-indexed):
    • GB NP_631063 (Start-406)
      • expression tag (407-410)
    Domains in SCOPe 2.07: d2dkka1, d2dkka2
  • Heterogens: HEM, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dkkA (A:)
    mtqetttltgqspppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatry
    ddvkaitndprfgraevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgat
    krlrpraqeildglvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrq
    iistsggaeaaerakrglygwitetvraragseggdvysmlgaavgrgevgeteavglag
    plqiggeavthnvgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglaria
    ledvevhgtriaagepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgav
    larmqtellvdtllerlpglrlavpaeqvawrrktmirgprtlpctwhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dkkA (A:)
    pppvrdwpaldldgpefdpvlaelmregpltrvrlphgegwawlatryddvkaitndprf
    graevtqrqitrlaphfkprpgslafadqpdhnrlrravagaftvgatkrlrpraqeild
    glvdgilaegppadlvervlepfpiavvsevmgvpaadrervhswtrqiistsggaeaae
    rakrglygwitetvraragseggdvysmlgaavgrgevgeteavglagplqiggeavthn
    vgqmlyllltrrelmarmrerpgargtaldellrwishrtsvglarialedvevhgtria
    agepvyvsylaanrdpdvfpdpdridldrdpnphlaygnghhfctgavlarmqtellvdt
    llerlpglrlavpaeqvawrrktmirgprtlpctwhhhh