PDB entry 2dkg

View 2dkg on RCSB PDB site
Description: Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii OT3 in Complex with Biotinyl-5'-AMP, Pyrophosphate and Mg(2+)
Class: ligase
Keywords: Biotin Biosynthesis, Dimer, X-ray Diffraction, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-11, released 2006-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-11, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.189
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dkga1, d2dkga2
  • Chain 'B':
    Compound: 235aa long hypothetical biotin-[acetyl-CoA-carboxylase] ligase
    Species: Pyrococcus horikoshii
    Gene: birA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2dkgb1, d2dkgb2
  • Heterogens: MG, BT5, POP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dkgA (A:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dkgB (B:)
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmilgvrvkilgdgsfegiaediddfgrliirldsgevkkviygdvslrfl