PDB entry 2dk3

View 2dk3 on RCSB PDB site
Description: Solution structure of Mib-herc2 domain in HECT domain containing protein 1
Class: protein binding
Keywords: NMR, Mib-herc2 domain, HECT domain containing protein 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-04-06, released 2006-10-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: E3 ubiquitin-protein ligase HECTD1
    Species: Homo sapiens [TaxId:9606]
    Gene: HECTD1, KIAA1131
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ULT8 (7-79)
      • cloning artifact (0-6)
      • cloning artifact (80-85)
    Domains in SCOPe 2.07: d2dk3a1, d2dk3a2, d2dk3a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dk3A (A:)
    gssgssgvrsqvlkymvpgarvirgldwkwrdqdgspqgegtvtgelhngwidvtwdagg
    snsyrmgaegkfdlklapgysgpssg