PDB entry 2dk1

View 2dk1 on RCSB PDB site
Description: Solution structure of WW domain in WW domain binding protein 4 (WBP-4)
Class: gene regulation
Keywords: NMR, WW domain, WW domain-binding protein 4, WBP-4, Formin-binding protein 21, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2006-04-06, released 2006-10-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: WW domain-binding protein 4
    Species: Homo sapiens [TaxId:9606]
    Gene: WBP4, FBP21
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75554 (7-43)
      • cloning artifact (0-6)
      • cloning artifact (44-49)
    Domains in SCOPe 2.08: d2dk1a1, d2dk1a2, d2dk1a3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dk1A (A:)
    gssgssgrwvegitsegyhyyydlisgasqwekpegfqgdlkktsgpssg