PDB entry 2djs

View 2djs on RCSB PDB site
Description: Solution structures of the fn3 domain of human ephrin type-B receptor 1
Class: signaling protein
Keywords: Tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-04-05, released 2006-10-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ephrin type-B receptor 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPHB1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54762 (7-101)
      • cloning artifact (0-6)
      • cloning artifact (102-107)
    Domains in SCOPe 2.05: d2djsa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2djsA (A:)
gssgssgpstvpimhqvsatmrsitlswpqpeqpngiildyeiryyekehnefnssmars
qtntaridglrpgmvyvvqvrartvagygkfsgkmcfqtltdsgpssg