PDB entry 2djs

View 2djs on RCSB PDB site
Description: Solution structures of the fn3 domain of human ephrin type-B receptor 1
Class: signaling protein
Keywords: Tyrosine-protein kinase receptor EPH-2, NET, HEK6, ELK, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-04-05, released 2006-10-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-10-05, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Ephrin type-B receptor 1
  Species: HOMO SAPIENS
  Gene: EPHB1
  Database cross-references and differences (RAF-indexed):
  • Uniprot P54762 (7-101)
    • cloning artifact (0-6)
    • cloning artifact (102-107)
  Domains in SCOP 1.75: d2djsa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2djsA (A:)
  gssgssgpstvpimhqvsatmrsitlswpqpeqpngiildyeiryyekehnefnssmars
  qtntaridglrpgmvyvvqvrartvagygkfsgkmcfqtltdsgpssg