PDB entry 2djq

View 2djq on RCSB PDB site
Description: The solution structure of the first SH3 domain of mouse SH3 domain containing ring finger 2
Class: structural genomics, unknown function
Keywords: SH3 domain, Mus musculus 0 day neonate head cDNA, RIKEN full-length enriched library, clone:4831401O22, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION
Deposited on 2006-04-05, released 2006-10-05
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SH3 domain containing ring finger 2
    Species: Mus musculus [TaxId:10090]
    Gene: Sh3rf2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8C122 (7-61)
      • cloning artifact (0-6)
      • cloning artifact (62-67)
    Domains in SCOPe 2.05: d2djqa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2djqA (A:)
gssgssgprakalcnyrgknpgdlkfnkgdvillrrqldenwyqgeingvsgifpassve
visgpssg