PDB entry 2djn

View 2djn on RCSB PDB site
Description: The solution structure of the homeobox domain of human Homeobox protein DLX-5
Class: transcription
Keywords: homeobox, DLX5, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-04-05, released 2006-10-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Homeobox protein DLX-5
    Species: Homo sapiens [TaxId:9606]
    Gene: DLX5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56178 (7-63)
      • cloning artifact (0-6)
      • cloning artifact (64-69)
    Domains in SCOPe 2.08: d2djna1, d2djna2, d2djna3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2djnA (A:)
    gssgssgrkprtiyssfqlaalqrrfqktqylalperaelaaslgltqtqvkiwfqnkrs
    kikksgpssg