PDB entry 2dj7

View 2dj7 on RCSB PDB site
Description: Solution Structure of 3rd LIM Domain of Actin-binding LIM Protein 3
Class: metal binding protein
Keywords: LIM domain, Actin-binding LIM protein 3, ZN binding protein, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2006-03-31, released 2006-10-01
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Actin-binding LIM protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: ABLIM3
    Database cross-references and differences (RAF-indexed):
    • Uniprot O94929 (7-73)
      • cloning artifact (0-6)
      • cloning artifact (74-79)
    Domains in SCOPe 2.01: d2dj7a1, d2dj7a2
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dj7A (A:)
gssgssgkpikirgpshcagckeeikhgqsllaldkqwhvscfkcqtcsviltgeyiskd
gvpycesdyhaqfgsgpssg