PDB entry 2dj4

View 2dj4 on RCSB PDB site
Description: Solution structure of the 13th filamin domain from human Filamin-B
Class: structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, NPPSFA, National Project on Protein Structural and Functional Analyses, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, STRUCTURAL PROTEIN
Deposited on 2006-03-31, released 2006-10-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Filamin-B
    Species: Homo sapiens [TaxId:9606]
    Gene: FLNB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75369 (7-107)
      • cloning artifact (0-6)
      • see remark 999 (60)
    Domains in SCOPe 2.06: d2dj4a1, d2dj4a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dj4A (A:)
gssgssgvvdpskvkiagpglgsgvrarvlqsftvdsskaglaplevrvlgprglvepvn
vvdngdgthtvtytpsqegpymvsvkyadeeiprspfkvkvlptydas