PDB entry 2diz

View 2diz on RCSB PDB site
Description: The solution structure of the third thioredoxin domain of human Thioredoxin domain-containing protein 5
Class: electron transport
Keywords: Thioredoxin-like protein p46, Endoplasmic reticulum protein ERp46, TLP46, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, ELECTRON TRANSPORT
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioredoxin domain-containing protein 5
    Species: Homo sapiens [TaxId:9606]
    Gene: TXNDC5
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBS9 (7-116)
      • cloning artifact (0-6)
    Domains in SCOPe 2.07: d2diza1, d2diza2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dizA (A:)
    gssgssgtvlaltennfddtiaegitfikfyapwcghcktlaptweelskkefpglagvk
    iaevdctaernicskysvrgyptlllfrggkkvsehsggrdldslhrfvlsqakdel