PDB entry 2dix

View 2dix on RCSB PDB site
Description: Solution structure of the DSRM domain of Protein activator of the interferon-induced protein kinase
Class: RNA binding protein
Keywords: NMR, structure genomics, DSRM domain, Hypothetical protein PRKRA, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Interferon-inducible double stranded RNA-dependent protein kinase activator A
    Species: Homo sapiens [TaxId:9606]
    Gene: PRKRA, DKFZp564I0123, PACT
    Database cross-references and differences (RAF-indexed):
    • Uniprot O75569 (7-77)
      • cloning artifact (0-6)
      • cloning artifact (78-83)
    Domains in SCOPe 2.07: d2dixa1, d2dixa2, d2dixa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dixA (A:)
    gssgssgktpiqvlheygmktknipvyecersdvqihvptftfrvtvgditctgegtskk
    lakhraaeaainilkanasgpssg