PDB entry 2diw

View 2diw on RCSB PDB site
Description: Solution structure of the RPR domain of Putative RNA-binding protein 16
Class: RNA binding protein
Keywords: NMR, structure genomics, RPR domain, Putative RNA-binding protein 16, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative RNA-binding protein 16
    Species: Homo sapiens [TaxId:9606]
    Gene: RBM16; KIAA1116
    Database cross-references and differences (RAF-indexed):
    • GB BAA83068 (7-145)
      • cloning artifact (0-6)
      • cloning artifact (146-151)
    Domains in SCOPe 2.08: d2diwa1, d2diwa2, d2diwa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2diwA (A:)
    gssgssgdnmeavktfnselyslndykppiskakmtqitkaaikaikfykhvvqsvekfi
    qkckpeykvpglyvidsivrqsrhqfgqekdvfaprfsnniistfqnlyrcpgddkskiv
    rvlnlwqknnvfkseiiqplldmaagsgpssg