PDB entry 2dit

View 2dit on RCSB PDB site
Description: Solution structure of the RRM_1 domain of HIV TAT specific factor 1 variant
Class: RNA binding protein
Keywords: NMR, structural genomics, RRM_1 domain, HIV TAT specific factor 1 variant, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: HIV TAT specific factor 1 variant
    Species: Homo sapiens [TaxId:9606]
    Gene: HIV TAT specific factor 1 variant
    Database cross-references and differences (RAF-indexed):
    • GB BAD92540 (7-105)
      • cloning artifact (0-6)
      • cloning artifact (106-111)
    Domains in SCOPe 2.06: d2dita1, d2dita2, d2dita3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2ditA (A:)
gssgssggpsrmrhervviiknmfhpmdfeddplvlneiredlrvecskfgqirklllfd
rhpdgvasvsfrdpeeadyciqtldgrwfggrqitaqawdgttdyqsgpssg