PDB entry 2dip

View 2dip on RCSB PDB site
Description: Solution structure of the ZZ domain of Zinc finger SWIM domain containing protein 2
Class: metal binding protein
Keywords: NMR, ZZ domain, Zinc finger SWIM domain containing protein 2, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, METAL BINDING PROTEIN
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Zinc finger SWIM domain-containing protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ZSWIM2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NEG5 (7-91)
      • cloning artifact (0-6)
      • cloning artifact (92-97)
    Domains in SCOPe 2.07: d2dipa1, d2dipa2, d2dipa3
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dipA (A:)
    gssgssgleefknssklvaaaekerldkhlgipcnnckqfpiegkcykctecieyhlcqe
    cfdsychlshtftfrekrnqkwrslekradevsgpssg