PDB entry 2dio

View 2dio on RCSB PDB site
Description: Crystal Structure of the Allene Oxide Cyclase 2 with bound inhibitor vernolic acid
Class: isomerase
Keywords: beta barrel, inhibitor complex
Deposited on 2006-03-30, released 2006-11-21
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-26, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.199
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-187)
      • modified residue (41)
    Domains in SCOP 1.75: d2dioa1
  • Chain 'B':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-187)
      • modified residue (41)
    Domains in SCOP 1.75: d2diob1
  • Chain 'C':
    Compound: Allene oxide cyclase 2
    Species: Arabidopsis thaliana
    Gene: AT3G25770
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9LS02 (Start-187)
      • modified residue (41)
    Domains in SCOP 1.75: d2dioc1
  • Heterogens: EOD, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dioA (A:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dioA (A:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2dioB (B:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dioB (B:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2dioC (C:)
    mrgshhhhhhrspskvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdl
    kkrvgitaglcvviehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggag
    ifegaygqvklqqlvyptklfytfylkglandlpleltgtpvppskdiepapeakaleps
    gvisnytn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dioC (C:)
    kvqelsvyeineldrhspkilknafslmfglgdlvpftnklytgdlkkrvgitaglcvvi
    ehvpekkgerfeatysfyfgdyghlsvqgpyltyedsflaitggagifegaygqvklqql
    vyptklfytfylkglandlpleltgtpvppskdiepapeakalepsgvisnytn