PDB entry 2dik

View 2dik on RCSB PDB site
Description: r337a mutant of pyruvate phosphate dikinase
Class: transferase
Keywords: phosphotransferase, kinase, transferase
Deposited on 1998-09-03, released 1998-09-16
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.185
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (pyruvate phosphate dikinase)
    Species: Clostridium symbiosum [TaxId:1512]
    Gene: PPDK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22983 (0-872)
      • engineered (335)
    Domains in SCOPe 2.05: d2dika1, d2dika2, d2dika3
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2dikA (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiykgdietqeasvsgsferimvwadkfrtlkvrtnad
    tpedtlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgd
    fkamykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpm
    mghrgcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvv
    vevaeqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrdd
    agkfldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssv
    efchkvglnyvscspfrvpiarlaaaqaalnnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2dikA (A:)
    akwvykfeegnasmrnllggkgcnlaemtilgmpipqgftvtteacteyynsgkqitqei
    qdqifeaitwleelngkkfgdtedpllvsvrsaarasmpgmmdtilnlglndvavegfak
    ktgnprfaydsyrrfiqmysdvvmevpkshfekiidamkeekgvhfdtdltaddlkelae
    kfkavykeamngeefpqepkdqlmgavkavfrswdnpraivyrrmndipgdwgtavnvqt
    mvfgnkgetsgtgvaftrnpstgekgiygeylinaqgedvvagvrtpqpitqlendmpdc
    ykqfmdlamklekhfrdmqdmeftieegklyflqtangkrtapaalqiacdlvdegmite
    eeavvrieaksldqllhptfnpaalkagevigsalpaspgaaagkvyftadeakaahekg
    ervilvrletspediegmhaaegiltvrggmtshaavvargmgtccvsgcgeikineeak
    tfelgghtfaegdyisldgstgkiietqeasvsgsferimvwadkfrtlkvrtnadtped
    tlnavklgaegiglcrtehmffeadrimkirkmilsdsveareealnelipfqkgdfkam
    ykalegrpmtvryldpplhefvphteeeqaelaknmgltlaevkakvdelhefnpmmghr
    gcrlavtypeiakmqtravmeaaievkeetgidivpeimiplvgekkelkfvkdvvveva
    eqvkkekgsdmqyhigtmieipraaltadaiaeeaeffsfgtndltqmtfgfsrddagkf
    ldsyykakiyesdpfarldqtgvgqlvemavkkgrqtrpglkcgicgehggdpssvefch
    kvglnyvscspfrvpiarlaaaqaalnnk