PDB entry 2dig

View 2dig on RCSB PDB site
Description: Solusion structure of the Todor domain of human Lamin-B receptor
Class: DNA binding protein
Keywords: Tudor domain, Integral nuclear envelope inner membrane protein, Nuclear protein, Receptor, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-30, released 2006-09-30
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-30, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Lamin-B receptor
  Species: HOMO SAPIENS
  Gene: LBR
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14739 (7-61)
    • cloning artifact (0-6)
    • cloning artifact (62-67)
  Domains in SCOP 1.73: d2diga1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2digA (A:)
  gssgssgmpsrkfadgevvrgrwpgsslyyeveilshdstsqlytvkykdgtelelkend
  iksgpssg