PDB entry 2dif

View 2dif on RCSB PDB site
Description: One sequence two fold ? : Miss fold of the zf-B-box domain from human tripartite motif protein 39
Class: protein binding
Keywords: zf-B-box domian, Zn binding, one sequence two fold, NPPSFA, National Project on Protein Structural and Functional Analyses, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, PROTEIN BINDING
Deposited on 2006-03-29, released 2006-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif protein 39
    Species: Homo sapiens [TaxId:9606]
    Gene: TRIM39
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCM9 (7-46)
      • cloning artifact (0-6)
      • cloning artifact (47-52)
    Domains in SCOPe 2.08: d2difa2, d2difa3, d2difa4
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2difA (A:)
    gssgssgeslcpqhhealslfcyedqeavclicaishthrahtvvplsgpssg