PDB entry 2did

View 2did on RCSB PDB site
Description: One sequence two fold ? : Correct fold of the zf-B-box domain from human tripartite motif protein 39
Class: protein binding
Keywords: zf-B-box domian, Zn binding, one sequence two fold, NPPSFA, National Project on Protein Structural and Functional Analyses, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-29, released 2006-09-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tripartite motif protein 39
    Species: HOMO SAPIENS
    Gene: TRIM39
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9HCM9 (7-46)
      • cloning artifact (0-6)
      • cloning artifact (47-52)
    Domains in SCOP 1.75: d2dida1
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2didA (A:)
    gssgssgeslcpqhhealslfcyedqeavclicaishthrahtvvplsgpssg