PDB entry 2dib

View 2dib on RCSB PDB site
Description: Solution structure of the 11th filamin domain from human Filamin-B
Class: Structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-29, released 2006-09-29
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-B
  Species: HOMO SAPIENS
  Gene: FLNB
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75369 (7-121)
    • cloning artifact (0-6)
    • cloning artifact (122-127)
  Domains in SCOP 1.73: d2diba1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dibA (A:)
  gssgssghfparvkvepavdtsrikvfgpgiegkdvfreattdftvdsrpltqvggdhik
  ahianpsgastecfvtdnadgtyqveytpfekglhvvevtyddvpipnspfkvavtegcq
  pssgpssg