PDB entry 2dib

View 2dib on RCSB PDB site
Description: Solution structure of the 11th filamin domain from human Filamin-B
Class: Structural protein
Keywords: beta-sandwich, immunoglobulin-like fold, filamin domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural protein
Deposited on 2006-03-29, released 2006-09-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Filamin-B
  Species: Homo sapiens [TaxId:9606]
  Gene: FLNB
  Database cross-references and differences (RAF-indexed):
  • Uniprot O75369 (7-121)
    • cloning artifact (0-6)
    • cloning artifact (122-127)
  Domains in SCOPe 2.08: d2diba1, d2diba2, d2diba3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dibA (A:)
  gssgssghfparvkvepavdtsrikvfgpgiegkdvfreattdftvdsrpltqvggdhik
  ahianpsgastecfvtdnadgtyqveytpfekglhvvevtyddvpipnspfkvavtegcq
  pssgpssg