PDB entry 2di4

View 2di4 on RCSB PDB site
Description: Crystal structure of the FtsH protease domain
Class: Hydrolase
Keywords: metalloproteinase, hexamer-ring
Deposited on 2006-03-28, released 2006-06-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-06-27, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.79 Å
R-factor: 0.254
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cell division protein ftsH homolog
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2di4a1
  • Chain 'B':
    Compound: Cell division protein ftsH homolog
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2di4b1
  • Heterogens: HG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2di4A (A:)
    fqgplgshmtispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpie
    dkhiydkkdlynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdk
    vgpiairrvanpflggmttavdtspdllreideevkriiteqyekakaiveeykeplkav
    vkklleketitceefvevfklygielkdkckkeelfdkdrkseenkelkseevkeevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2di4A (A:)
    tispkekekiaiheaghalmglvsddddkvhkisiikhiydkkdlynkilvllggraaee
    vffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideev
    kriiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2di4B (B:)
    fqgplgshmtispkekekiaiheaghalmglvsddddkvhkisiiprgmalgvtqqlpie
    dkhiydkkdlynkilvllggraaeevffgkdgittgaendlqratdlayrmvsmwgmsdk
    vgpiairrvanpflggmttavdtspdllreideevkriiteqyekakaiveeykeplkav
    vkklleketitceefvevfklygielkdkckkeelfdkdrkseenkelkseevkeevv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2di4B (B:)
    ispkekekiaiheaghalmglvsddddkvhkisiiphiydkkdlynkilvllggraaeev
    ffgkdgittgaendlqratdlayrmvsmwgmsdkvgpiairrtavdtspdllreideevk
    riiteqyekakaiveeykeplkavvkklleketitceefvevfklygielkdkck