PDB entry 2di0

View 2di0 on RCSB PDB site
Description: Solution Structure of the CUE Domain in the Human Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2)
Class: transcription
Keywords: activating signal cointegrator 1 complex subunit 2, ASCC2, CUE domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-27, released 2006-09-27
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-27, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Activating signal cointegrator 1 complex subunit 2
  Species: HOMO SAPIENS
  Gene: ASCC2, ASC1P100
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9H1I8 (7-70)
    • cloning artifact (0-6)
    • see remark 999 (70)
  Domains in SCOP 1.73: d2di0a1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2di0A (A:)
  gssgssgmcgveldslisqvkdllpdlgegfilacleyyhydpeqvinnileerlaptls
  qldrnldremn