PDB entry 2di0

View 2di0 on RCSB PDB site
Description: Solution Structure of the CUE Domain in the Human Activating Signal Cointegrator 1 Complex Subunit 2 (ASCC2)
Class: transcription
Keywords: activating signal cointegrator 1 complex subunit 2, ASCC2, CUE domain, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, TRANSCRIPTION
Deposited on 2006-03-27, released 2006-09-27
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Activating signal cointegrator 1 complex subunit 2
    Species: Homo sapiens [TaxId:9606]
    Gene: ASCC2, ASC1P100
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9H1I8 (7-70)
      • cloning artifact (0-6)
      • see remark 999 (70)
    Domains in SCOPe 2.08: d2di0a1, d2di0a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2di0A (A:)
    gssgssgmcgveldslisqvkdllpdlgegfilacleyyhydpeqvinnileerlaptls
    qldrnldremn