PDB entry 2dhn

View 2dhn on RCSB PDB site
Description: complex of 7,8-dihydroneopterin aldolase from staphylococcus aureus with 6-hydroxymethyl-7,8-dihydropterin at 2.2 a resolution
Deposited on 1998-03-31, released 1999-04-20
The last revision prior to the SCOP 1.55 freeze date was dated 1999-04-20, with a file datestamp of 1999-04-19.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.202
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2dhn__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dhn_ (-)
  mqdtiflkgmrfygyhgalsaeneigqifkvdvtlkvdlseagrtdnvidtvhygevfee
  vksimegkavnllehlaerianrinsqynrvmetkvritkenppipghydgvgieivren
  k