PDB entry 2dhj

View 2dhj on RCSB PDB site
Description: Solution structure of the PH domain of Rho GTPase activating protein 21 from human
Class: signaling protein
Keywords: PH domain, Rho GTPase activating protein 21, structural genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, SIGNALING PROTEIN
Deposited on 2006-03-24, released 2006-09-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Rho GTPase activating protein 21
  Species: Homo sapiens [TaxId:9606]
  Gene: ARHGAP21
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q7Z3P7 (7-118)
    • cloning artifact (0-6)
    • cloning artifact (119-124)
  Domains in SCOPe 2.08: d2dhja1, d2dhja2, d2dhja3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dhjA (A:)
  gssgssgdaakegwlhfrplvtdkgkrvggsirpwkqmyvvlrghslylykdkreqttps
  eeeqpisvnaclidisysetkrknvfrlttsdceclfqaedrddmlawiktiqessnlns
  gpssg