PDB entry 2dhb

View 2dhb on RCSB PDB site
Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1973-11-01, released 1977-06-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2014-10-29, with a file datestamp of 2014-10-24.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hemoglobin (deoxy) (alpha chain)
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01958 (0-140)
    • conflict (62)
    • conflict (64)
    • conflict (81)
    • conflict (84)
  Domains in SCOPe 2.05: d2dhba_
• Chain 'B':
  Compound: hemoglobin (deoxy) (beta chain)
  Species: Equus caballus [TaxId:9796]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P02062 (0-145)
    • conflict (110-111)
    • conflict (113)
  Domains in SCOPe 2.05: d2dhbb_
• Heterogens: HEM, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dhbA (A:)
  vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
  kvadgltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
  vhasldkflssvstvltskyr
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dhbB (B:)
  vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
  kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlalvvarhfgk
  dftpelqasyqkvvagvanalahkyh