PDB entry 2dhb

View 2dhb on RCSB PDB site
Description: three dimensional fourier synthesis of horse deoxyhaemoglobin at 2.8 angstroms resolution
Class: oxygen transport
Keywords: oxygen transport
Deposited on 1973-11-01, released 1977-06-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-04-04, with a file datestamp of 2018-03-29.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: N/A
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin (deoxy) (alpha chain)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • conflict (62)
      • conflict (64)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.08: d2dhba_
  • Chain 'B':
    Compound: hemoglobin (deoxy) (beta chain)
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02062 (0-145)
      • conflict (110-111)
      • conflict (113)
    Domains in SCOPe 2.08: d2dhbb_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhbA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvadgltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dhbB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlalvvarhfgk
    dftpelqasyqkvvagvanalahkyh