PDB entry 2dgz

View 2dgz on RCSB PDB site
Description: Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
Class: DNA binding protein
Keywords: HRDC domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2006-03-16, released 2006-09-16
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-16, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Werner syndrome protein variant
  Species: HOMO SAPIENS
  Gene: WRN
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14191 (7-106)
    • cloning artifact (0-6)
    • cloning artifact (107-112)
  Domains in SCOP 1.73: d2dgza1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2dgzA (A:)
  gssgssgssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrp
  ttvenvkridgvsegkaamlaplwevikhfcqtnsvqtdlfsstkpqsgpssg