PDB entry 2dgz

View 2dgz on RCSB PDB site
Description: Solution structure of the Helicase and RNase D C-terminal domain in Werner syndrome ATP-dependent helicase
Class: DNA binding protein
Keywords: HRDC domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, DNA BINDING PROTEIN
Deposited on 2006-03-16, released 2006-09-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Werner syndrome protein variant
    Species: Homo sapiens [TaxId:9606]
    Gene: WRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q14191 (7-106)
      • cloning artifact (0-6)
      • cloning artifact (107-112)
    Domains in SCOPe 2.08: d2dgza1, d2dgza2, d2dgza3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2dgzA (A:)
gssgssgssqpvisaqeqetqivlygklvearqkhankmdvppailatnkilvdmakmrp
ttvenvkridgvsegkaamlaplwevikhfcqtnsvqtdlfsstkpqsgpssg