PDB entry 2dgp

View 2dgp on RCSB PDB site
Description: Solution structure of the N-terminal RNA binding domain in Bruno-like 4 RNA-binding protein
Class: RNA binding protein
Keywords: RRM domain, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, RNA BINDING PROTEIN
Deposited on 2006-03-15, released 2006-09-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bruno-like 4, RNA binding protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRUNOL4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ96 (7-100)
      • cloning artifact (0-6)
      • cloning artifact (101-105)
    Domains in SCOPe 2.08: d2dgpa1, d2dgpa2, d2dgpa3

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2dgpA (A:)
    gssgssgmkdhdaiklfigqiprnldekdlkplfeefgkiyeltvlkdrftgmhkgcafl
    tyceresalkaqsalheqktlpgmnrpiqvkpadsesrggsgpssg